PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.010G032600.2
Common NamePHAVU_010G032600g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family FAR1
Protein Properties Length: 178aa    MW: 19995.9 Da    PI: 8.4982
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.010G032600.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR182.28.6e-2670159190
                FAR1   1 kfYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHela 90 
                         +fY+eYA++ GF vr ++ ++s+ +++i++r+f C+k+g++ + ++kt+  +++r++ r gC+a++ vk +k gkw+vtk+++eH+H l+
  Phvul.010G032600.2  70 NFYDEYARQEGFVVRLDRCHRSEVDNRIISRRFSCNKQGFHVRVRNKTKPVHKPRTSIREGCEAMMLVKVNKCGKWVVTKFVKEHSHLLN 159
                         6*******************************************9999***************************************885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031016.2E-2370159IPR004330FAR1 DNA binding domain
Sequence ? help Back to Top
Protein Sequence    Length: 178 aa     Download sequence    Send to blast
HTPSLLNFLT LSSTNLTLLA HNPVLISMDL EAVAETVENC TDKISAAFEG SSIVEPNVGM  60
EFDSEEAAKN FYDEYARQEG FVVRLDRCHR SEVDNRIISR RFSCNKQGFH VRVRNKTKPV  120
HKPRTSIREG CEAMMLVKVN KCGKWVVTKF VKEHSHLLNA SGSPSYSKMI VSFIFNS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150420.0AP015042.1 Vigna angularis var. angularis DNA, chromosome 9, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007134266.11e-131hypothetical protein PHAVU_010G032600g, partial
TrEMBLV7ALY71e-131V7ALY7_PHAVU; Uncharacterized protein (Fragment)
STRINGGLYMA03G22670.21e-84(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G43280.16e-40FAR1 family protein